Matrix Science Mascot Parser toolkit
 
Loading...
Searching...
No Matches
resfile_summary.cs

Example program for extracting the peptide or protein summary.

/*
##############################################################################
# file: resfile_summary.cs #
# 'msparser' toolkit example code #
##############################################################################
# COPYRIGHT NOTICE #
# Copyright 1998-2016 Matrix Science Limited All Rights Reserved. #
# #
##############################################################################
# $Source: parser/examples/test_csharp/resfile_summary.cs $#
# $Author: robertog@matrixscience.com $ #
# $Date: 2024-09-04 10:23:46 +0100 $ #
# $Revision: 526921a73137894bb1eae0b0fc8ccb4bb52ea662 | MSPARSER_REL_3_0_0-2024-09-24-0-g93ebaeb4f4 $ #
# $NoKeywords:: $ #
##############################################################################
*/
using System;
using System.Text.RegularExpressions;
using matrix_science.msparser;
namespace MsParserExamples
{
public class resfile_summary
{
public static int Main(string[] argv)
{
// ----- Object creation -----
if (argv.Length < 1)
{
Console.WriteLine("Must specify results filename as parameter");
return 1;
}
int returnValue = 1; //failure
ms_mascotresfilebase file = ms_mascotresfilebase.createResfile(argv[0], 0, "");
if (checkErrors(file))
{
/*
* The parameters passed to ms_peptidesummary or ms_proteinsummary determine
* the type of grouping and the number of proteins and peptides displayed.
* Default parameters can be returned using ms_mascotresfilebase::get_ms_mascotresults_params().
* The return values from this function depend on the type of search,
* and also on values in the mascot.dat configuration file if that is available.
*/
ms_datfile datfile = new ms_datfile("../config/mascot.dat"); //You may need to change this path
//if the mascot.dat isn't available, use defaults
ms_mascotoptions mascotOptions = new ms_mascotoptions();
if (datfile.isValid())
{
mascotOptions = datfile.getMascotOptions();
}
uint flags, flags2, minPepLenInPepSummary;
int maxHitsToReport;
double minProbability, ignoreIonsScoreBelow;
bool usePeptideSummary;
string scriptName = file.get_ms_mascotresults_params(
mascotOptions,
out flags,
out minProbability,
out maxHitsToReport,
out ignoreIonsScoreBelow,
out minPepLenInPepSummary,
out usePeptideSummary,
out flags2);
bool bResult;
if (usePeptideSummary)
{
/*
* For peptide summary
*
* Flags defined for hierarchical clustering algorithm:
* flags: ms_mascotresults::MSRES_CLUSTER_PROTEINS
* | ms_mascotresults::MSRES_SHOW_SUBSETS
* | ms_mascotresults::MSRES_MUDPIT_PROTEIN_SCORE;
* flags2: ms_peptidesummary::MSPEPSUM_USE_HOMOLOGY_THRESH;
*
* Flags defined for original simple parsimony algorithm:
* flags: ms_mascotresults::MSRES_GROUP_PROTEINS | ms_mascotresults::MSRES_SHOW_SUBSETS;
*/
Console.WriteLine("-------------------------------------------------------------");
Console.WriteLine("--- Peptide summary report ---");
Console.WriteLine("-------------------------------------------------------------");
bResult = showResults(file,
usePeptideSummary,
flags,
minProbability,
maxHitsToReport,
ignoreIonsScoreBelow,
(int)minPepLenInPepSummary,
flags2);
}
else
{
// Show results from full protein summary, remove grouping
flags &= ~(uint)ms_mascotresults.FLAGS.MSRES_GROUP_PROTEINS;
flags &= ~(uint)ms_mascotresults.FLAGS.MSRES_SHOW_SUBSETS;
Console.WriteLine("-------------------------------------------------------------");
Console.WriteLine("--- Full Protein summary report ---");
Console.WriteLine("-------------------------------------------------------------");
bResult = showResults(file,
usePeptideSummary,
flags,
minProbability,
maxHitsToReport,
ignoreIonsScoreBelow,
(int)minPepLenInPepSummary,
flags2);
if (bResult && checkErrors(file))
{
// Show results from concise protein summary, add grouping
flags |= (uint)ms_mascotresults.FLAGS.MSRES_GROUP_PROTEINS;
flags |= (uint)ms_mascotresults.FLAGS.MSRES_SHOW_SUBSETS;
Console.WriteLine("-------------------------------------------------------------");
Console.WriteLine("--- Concise Protein summary report ---");
Console.WriteLine("-------------------------------------------------------------");
bResult = showResults(file,
usePeptideSummary,
flags,
minProbability,
maxHitsToReport,
ignoreIonsScoreBelow,
(int)minPepLenInPepSummary,
flags2);
}
}
if (bResult && checkErrors(file))
{
returnValue = 0; //success
}
}
//ms_mascotresults has a reference on ms_mascotresfilebase, therefore the GC must not delete it too early
GC.KeepAlive(file);
return returnValue;
}
private static bool showResults(ms_mascotresfilebase file,
bool pepSum,
uint flags,
double minProteinProb,
int maxHits,
double minIonsScore,
int minPepLenInPepSummary,
uint flags2)
{
int hit, num_peps, i, query, p, u, family, dbIdx;
string accession, description;
double mass;
ms_mascotresults results;
ms_protein prot;
ms_peptide pep;
if (pepSum)
{
results = new ms_peptidesummary(file,
flags,
minProteinProb,
maxHits,
"", //unigene file
minIonsScore,
minPepLenInPepSummary,
null,
flags2);
}
else
{
results = new ms_proteinsummary(file,
flags,
minProteinProb,
maxHits,
null,
null);
}
if (!checkErrors(file))
{
return false;
}
Console.WriteLine("{0} acid database", ((results.isNA()) ? "Nucleic" : "Amino"));
family = 1;
// get hit one
hit = 1;
prot = results.getHit(hit);
while (hit <= results.getNumberOfHits())
{
accession = prot.getAccession();
dbIdx = prot.getDB();
description = results.getProteinDescription(accession);
mass = results.getProteinMass(accession);
if ((flags & (uint)ms_mascotresults.FLAGS.MSRES_CLUSTER_PROTEINS) > 0)
{
Console.WriteLine("Protein Hit {0}.{1}\n===================", hit, family);
}
else
{
Console.WriteLine("Protein Hit {0}\n===================", hit);
}
Console.WriteLine("Accession : {0}", accession);
Console.WriteLine("Description : {0}", description);
Console.WriteLine("Score : {0:#}", prot.getScore());
Console.WriteLine("Mass : {0}", mass);
Console.WriteLine("Frame : {0}", prot.getFrame());
Console.WriteLine("Coverage : {0}", prot.getCoverage());
Console.WriteLine("RMS error : {0}", prot.getRMSDeltas(results));
Console.WriteLine("Peptides : {0}", prot.getNumDisplayPeptides());
// Each protein has a number of peptides that matched - list them
num_peps = prot.getNumPeptides();
for (i = 1; i <= num_peps; i++)
{
query = prot.getPeptideQuery(i);
p = prot.getPeptideP(i);
if (p != -1 && query != -1 && prot.getPeptideDuplicate(i) != ms_protein.DUPLICATE.DUPE_DuplicateSameQuery)
{
pep = results.getPeptide(query, p);
if (pep != null)
{
displayPeptideInfo(false, pep, results, prot.getPeptideDuplicate(i) == ms_protein.DUPLICATE.DUPE_Duplicate,
prot.getPeptideIsBold(i), prot.getPeptideShowCheckbox(i));
}
}
}
// now display list of all proteins that contained subsets or an identical list of the matching peptides
if ((flags & (uint) ms_mascotresults.FLAGS.MSRES_GROUP_PROTEINS) > 0 ||
(flags & (uint)ms_mascotresults.FLAGS.MSRES_CLUSTER_PROTEINS) > 0)
{
Console.WriteLine("Proteins matching the same set of peptides:");
i = 1;
while ((prot = results.getNextSimilarProteinOf(accession, dbIdx, i)) != null)
{
string similar_accession = prot.getAccession();
int similar_dbIdx = prot.getDB();
if ((flags & (uint)ms_mascotresults.FLAGS.MSRES_CLUSTER_PROTEINS) > 0 && similar_dbIdx > 1)
{
Console.Write("{0}::", similar_dbIdx);
}
Console.WriteLine("{0} Total score: {1:#} Peptides matched: {2}", similar_accession,
prot.getScore(), prot.getNumDisplayPeptides());
i++;
}
if ((flags & ((uint) ms_mascotresults.FLAGS.MSRES_SHOW_SUBSETS)) > 0)
{
Console.WriteLine("Proteins matching a subset of these peptides:");
i = 1;
while ((prot = results.getNextSubsetProteinOf(accession, dbIdx, i)) != null)
{
string subset_accession = prot.getAccession();
int subset_dbIdx = prot.getDB();
if ((flags & (uint)ms_mascotresults.FLAGS.MSRES_CLUSTER_PROTEINS) > 0 && subset_dbIdx > 1)
{
Console.Write("{0}::", subset_dbIdx);
}
Console.WriteLine("{0} Total score: {1:#} Peptides matched: {2}", subset_accession,
prot.getScore(), prot.getNumDisplayPeptides());
if ((flags & (uint)ms_mascotresults.FLAGS.MSRES_CLUSTER_PROTEINS) > 0)
{
int j = 1;
if (results.getNextSimilarProteinOf(subset_accession, subset_dbIdx, j) != null)
{
Console.WriteLine(" Proteins matching the same set of peptides for this subset:");
}
ms_protein similar_subset_prot;
while ((similar_subset_prot =
results.getNextSimilarProteinOf(subset_accession, subset_dbIdx, j)) != null)
{
string similar_subset_accession = similar_subset_prot.getAccession();
int similar_subset_dbIdx = similar_subset_prot.getDB();
Console.Write(" ");
if (similar_subset_dbIdx > 1)
{
Console.Write("{0}::", similar_subset_dbIdx);
}
Console.WriteLine("{0} Total score: {1:#} Peptides matched: {2}",
similar_subset_accession, similar_subset_prot.getScore(),
similar_subset_prot.getNumDisplayPeptides());
j++;
}
}
i++;
}
}
}
Console.WriteLine();
Console.WriteLine();
if ((flags & (uint)ms_mascotresults.FLAGS.MSRES_CLUSTER_PROTEINS) > 0)
{
prot = results.getNextFamilyProtein(hit, family++);
if(prot == null)
{
hit++;
prot = results.getHit(hit);
family = 1;
}
}
else
{
hit++;
prot = results.getHit(hit);
}
}
results.createUnassignedList(ms_mascotresults.sortBy.SCORE);
if (results.getNumberOfUnassigned() > 0)
{
Console.WriteLine("Unassigned list");
Console.WriteLine("---------------");
for (u = 1; u <= results.getNumberOfUnassigned(); u++)
{
pep = results.getUnassigned(u);
displayPeptideInfo(false, pep, results, false, true, true);
}
}
if (pepSum) displayYellowPopupInfo(results, 1);
return true;
} //method
private static void displayYellowPopupInfo(ms_mascotresults results, int queryNo)
{
int p;
ms_peptide pep;
String seq, tmp, hit, protein, morethan = "";
Regex regex = new Regex(@"(\d):([^ ]*)[ ]*(.*)");
Console.WriteLine("Score Delta Hit Protein Peptide");
for (p = 1; p <= 10; p++)
{
if ((pep = results.getPeptide(queryNo, p)) != null)
{
seq = pep.getPeptideStr();
if (seq.Length > 0)
{
tmp = results.getProteinsWithThisPepMatch(queryNo, p, true);
hit = " ";
protein = " ";
morethan = "";
if (tmp.Length > 0)
{
if (regex.IsMatch(tmp))
{
Match OneMatch = regex.Match(tmp);
if (OneMatch.Success)
{
int groupCount = OneMatch.Groups.Count;
if (groupCount >= 2) hit = OneMatch.Groups[1].Value;
if (groupCount >= 3) protein = OneMatch.Groups[2].Value;
if (groupCount >= 4) morethan = OneMatch.Groups[3].Value;
}
}
if (morethan.Length > 0)
{
hit = hit+"+";
}
}
Console.WriteLine("{0} {1} {2} {3} {4}", pep.getIonsScore(), pep.getDelta(), hit, protein, pep.getPeptideStr());
}
}
}
p = 1;
Console.WriteLine("Accessions that matched query {0} rank {1}:- {2}", queryNo, p, results.getProteinsWithThisPepMatch(queryNo, p, false));
} //method
private static void displayPeptideInfo(bool showFullDetails, ms_peptide p, ms_mascotresults r, bool isDuplicate, bool isBold, bool showCheckBox)
{
int q = p.getQuery();
if (showFullDetails)
{
Console.WriteLine("Peptide hit");
if (p.getAnyMatch())
{
Console.WriteLine(" Query : {0}", q);
Console.WriteLine(" Rank : {0}", p.getRank());
Console.WriteLine(" Matched : {0}", p.getAnyMatch());
Console.WriteLine(" missedCleave: {0}", p.getMissedCleavages());
Console.WriteLine(" mrCalc : {0}", p.getMrCalc());
Console.WriteLine(" delta : {0}", p.getDelta());
Console.WriteLine(" observed : {0}", p.getObserved());
Console.WriteLine(" charge : {0}", p.getCharge());
Console.WriteLine(" mrExp : {0}", p.getMrExperimental());
Console.WriteLine(" ionsMatched : {0}", p.getNumIonsMatched());
Console.WriteLine(" peptideStr : {0}", p.getPeptideStr());
Console.WriteLine(" peaksUsed1 : {0}", p.getPeaksUsedFromIons1());
Console.WriteLine(" varModsStr : {0}", p.getVarModsStr());
Console.WriteLine(" readable mod: {0}", r.getReadableVarMods(q, p.getRank(), 2));
Console.WriteLine(" ionsScore : {0}", p.getIonsScore());
Console.WriteLine(" seriesUsedS : {0}", p.getSeriesUsedStr());
Console.WriteLine(" peaksUsed2 : {0}", p.getPeaksUsedFromIons2());
Console.WriteLine(" peaksUsed3 : {0}", p.getPeaksUsedFromIons3());
Console.WriteLine(" idth, hth, p: {0}, {1}, {2}", r.getPeptideIdentityThreshold(q, 20),
r.getHomologyThreshold(q, 20), r.getProbOfPepBeingRandomMatch(p.getIonsScore(), q));
Console.WriteLine();
}
else
{
Console.WriteLine(" No match");
}
}
else
{
if (showCheckBox) Console.Write("CB ");
else Console.Write("-- ");
if (isBold) Console.Write("BOLD ");
else Console.Write("dim ");
Console.Write(q.ToString().PadLeft(4));
Console.Write(" ");
double observed = p.getObserved();
Console.Write(" ");
Console.Write(string.Format("{0}", observed.ToString("0.000000")).PadLeft(11));
Console.Write(" ");
Console.Write(p.getRank().ToString().PadLeft(4));
Console.Write("({0})", p.getPrettyRank().ToString().PadLeft(4));
Console.Write(" ");
Console.Write(p.getPeptideStr().ToString().PadLeft(20));
Console.Write(" ");
double score = p.getIonsScore();
Console.Write(string.Format("{0}{1}{2}", (isDuplicate) ? "(" : "", score.ToString("0.00"), (isDuplicate) ? ")" : "").PadLeft(8));
Console.Write(" ");
if (r.getReadableVarMods(q, p.getRank(), 2).Length == 0) Console.WriteLine(" 0");
else
{
string let = r.getReadableVarMods(q, p.getRank(), 2).Substring(0, 1);
int iLet;
if (int.TryParse(let, out iLet))
{
Console.WriteLine(" {0}", iLet);
}
else Console.WriteLine(" 0");
}
}
} //method
private static bool checkErrors(ms_mascotresfilebase file)
{
for (int loop = 1; loop <= file.getNumberOfErrors(); loop++)
{
Console.WriteLine("Error number: {0} : {1}", file.getErrorNumber(loop), file.getErrorString(loop));
}
// Call isValid before clearAllErrors, otherwise this method always returns true
bool isValid = file.isValid();
file.clearAllErrors();
return isValid;
} //method
} //class
} //namespace
/*
resfile_summary.exe c:\inetpub\mascot\data\F981123.dat
Will give the following output:
-------------------------------------------------------------
--- Peptide summary report ---
-------------------------------------------------------------
Amino acid database
Protein Hit 1
===================
Accession : CH60_HUMAN
Description : 60 kDa heat shock protein, mitochondrial OS=Homo sapiens GN=HSPD1
PE=1 SV=2
Score : 1225
Mass : 61016.38
Frame : 0
Coverage : 283
RMS error : 30.4200726378481
Peptides : 31
CB BOLD 11 417.182190 1( 1) APGFGDNR 45.35 0
CB BOLD 12 422.743286 1( 1) VGEVIVTK 45.74 0
CB BOLD 13 430.732788 1( 1) IPAMTIAK 36.27 0
CB BOLD 15 451.249908 1( 1) LSDGVAVLK 51.95 0
CB BOLD 16 456.780609 1( 1) VGLQVVAVK 59.00 0
CB BOLD 21 480.744690 1( 1) VTDALNATR 45.33 0
CB BOLD 24 595.785522 1( 1) EIGNIISDAMK (56.55) 0
CB BOLD 25 603.771973 1( 1) EIGNIISDAMK 59.52 0
CB BOLD 26 608.309875 1( 1) NAGVEGSLIVEK 73.21 0
CB BOLD 27 617.285706 1( 1) VGGTSDVEVNEK 80.63 0
CB BOLD 31 672.837524 1( 1) TVIIEQSWGSPK 64.38 0
CB BOLD 34 714.888428 1( 1) GVMLAVDAVIAELK (64.52) 0
CB BOLD 35 714.893799 1( 1) GVMLAVDAVIAELK (72.61) 0
CB BOLD 36 722.884888 1( 1) GVMLAVDAVIAELK 75.19 0
CB BOLD 37 722.893372 1( 1) GVMLAVDAVIAELK (72.57) 0
CB BOLD 39 752.864319 1( 1) TLNDELEIIEGMK 89.56 0
CB BOLD 40 760.846130 1( 1) TLNDELEIIEGMK (88.82) 0
CB BOLD 45 640.328125 1( 1) ISSIQSIVPALEIANAHR 101.50 0
CB BOLD 46 960.032715 1( 1) ISSIQSIVPALEIANAHR (87.34) 0
CB BOLD 48 1019.510620 1( 1) IQEIIEQLDVTTSEYEK 52.42 0
CB BOLD 51 1057.053711 1( 1) ALMLQGVDLLADAVAVTMGPK 115.78 0
CB BOLD 52 1065.039917 1( 1) ALMLQGVDLLADAVAVTMGPK (71.79) 0
CB BOLD 53 1065.062256 1( 1) ALMLQGVDLLADAVAVTMGPK (26.17) 0
CB BOLD 54 1073.047729 1( 1) ALMLQGVDLLADAVAVTMGPK (92.82) 2
CB BOLD 58 789.106201 1( 1) KPLVIIAEDVDGEALSTLVLNR (55.53) 0
CB BOLD 59 1183.156982 1( 1) KPLVIIAEDVDGEALSTLVLNR (65.46) 0
CB BOLD 60 789.109375 1( 1) KPLVIIAEDVDGEALSTLVLNR 94.59 0
CB BOLD 61 828.123779 1( 1) TALLDAAGVASLLTTAEVVVTEIPK (26.50) 0
CB BOLD 62 828.132202 1( 1) TALLDAAGVASLLTTAEVVVTEIPK 47.53 0
CB BOLD 64 854.058777 1( 1) LVQDVANNTNEEAGDGTTTATVLAR 75.15 0
CB BOLD 65 1038.503052 1( 1) DMAIATGGAVFGEEGLTLNLEDVQPHDLGK 13.05 0
Proteins matching the same set of peptides:
Proteins matching a subset of these peptides:
CH60_PONAB Total score: 1008 Peptides matched: 25
CH60_CRIGR Total score: 951 Peptides matched: 23
CH60_MOUSE Total score: 951 Peptides matched: 23
CH60_RAT Total score: 951 Peptides matched: 23
CH60_BOVIN Total score: 918 Peptides matched: 22
CH60_CHICK Total score: 876 Peptides matched: 19
CH60_MESAU Total score: 664 Peptides matched: 18
CH60C_DROME Total score: 121 Peptides matched: 2
CH60C_ARATH Total score: 91 Peptides matched: 2
HSP60_CANAL Total score: 45 Peptides matched: 1
HSP60_EMENI Total score: 45 Peptides matched: 1
HSP60_PARBA Total score: 45 Peptides matched: 1
HSP60_YEAST Total score: 45 Peptides matched: 1
CH602_VIBPA Total score: 45 Peptides matched: 1
CH602_VIBVU Total score: 45 Peptides matched: 1
CH602_VIBVY Total score: 45 Peptides matched: 1
CH60_EUGGR Total score: 45 Peptides matched: 1
Protein Hit 2
===================
Accession : CH60_DROME
Description : 60 kDa heat shock protein, mitochondrial OS=Drosophila melanogaste
r GN=Hsp60 PE=1 SV=3
Score : 174
Mass : 60770.89
Frame : 0
Coverage : 67
RMS error : 29.5905072791318
Peptides : 4
-- dim 11 417.182190 1( 1) APGFGDNR 45.35 0
-- dim 27 617.285706 2( 2) VGGSSEVEVNEK 41.69 0
-- dim 59 1183.156982 2( 2) KPLVIIAEDIDGEALSTLVVNR 12.20 0
-- dim 64 854.058777 1( 1) LVQDVANNTNEEAGDGTTTATVLAR 75.15 0
Proteins matching the same set of peptides:
Proteins matching a subset of these peptides:
HSP60_SCHPO Total score: 87 Peptides matched: 2
Protein Hit 3
===================
Accession : CH60_CAEEL
Description : Chaperonin homolog Hsp-60, mitochondrial OS=Caenorhabditis elegans
GN=hsp-60 PE=1 SV=2
Score : 135
Mass : 60063.75
Frame : 0
Coverage : 21
RMS error : 36.5383063193603
Peptides : 3
-- dim 11 417.182190 1( 1) APGFGDNR 45.35 0
-- dim 39 752.864319 2( 1) TLNDELELIEGMK 89.56 0
-- dim 40 760.846130 2( 1) TLNDELELIEGMK (88.82) 0
Proteins matching the same set of peptides:
Proteins matching a subset of these peptides:
Protein Hit 4
===================
Accession : CH60_STRM5
Description : 60 kDa chaperonin OS=Stenotrophomonas maltophilia (strain R551-3)
GN=groL PE=3 SV=1
Score : 42
Mass : 57311.84
Frame : 0
Coverage : 9
RMS error : 76.92376960617
Peptides : 1
-- dim 16 456.780609 2( 2) GIVKVVAVK 42.20 0
Proteins matching the same set of peptides:
CH60_STRMK Total score: 42 Peptides matched: 1
CH60_XANAC Total score: 42 Peptides matched: 1
CH60_XANC5 Total score: 42 Peptides matched: 1
CH60_XANC8 Total score: 42 Peptides matched: 1
CH60_XANCB Total score: 42 Peptides matched: 1
CH60_XANCH Total score: 42 Peptides matched: 1
CH60_XANCP Total score: 42 Peptides matched: 1
CH60_XANOM Total score: 42 Peptides matched: 1
CH60_XANOP Total score: 42 Peptides matched: 1
CH60_XANOR Total score: 42 Peptides matched: 1
Proteins matching a subset of these peptides:
Protein Hit 5
===================
Accession : NMDE4_HUMAN
Description :
Score : 37
Mass : 0
Frame : 0
Coverage : 10
RMS error : 9.41906700790969
Peptides : 1
-- dim 16 456.780609 3( 3) VAAGVAVVAR 37.24 0
Proteins matching the same set of peptides:
NMDE4_MOUSE Total score: 37 Peptides matched: 1
NMDE4_RAT Total score: 36 Peptides matched: 1
Proteins matching a subset of these peptides:
Protein Hit 6
===================
Accession : YF81_THET2
Description :
Score : 35
Mass : 0
Frame : 0
Coverage : 9
RMS error : 37.0214184966023
Peptides : 1
-- dim 16 456.780609 4( 4) VAQVLGVVK 34.76 0
Proteins matching the same set of peptides:
Y1944_THET8 Total score: 35 Peptides matched: 1
Proteins matching a subset of these peptides:
Protein Hit 7
===================
Accession : F4ST_FLACH
Description :
Score : 34
Mass : 0
Frame : 0
Coverage : 9
RMS error : 87.8815544838649
Peptides : 1
-- dim 15 451.249908 2( 2) LSATGLVLK 33.85 0
Proteins matching the same set of peptides:
Proteins matching a subset of these peptides:
Protein Hit 8
===================
Accession : ZN711_HUMAN
Description : Zinc finger protein 711 OS=Homo sapiens GN=ZNF711 PE=1 SV=2
Score : 31
Mass : 86190.24
Frame : 0
Coverage : 13
RMS error : 69.4028633218151
Peptides : 1
CB BOLD 33 714.364929 1( 1) EASPLSSNKLILR 30.84 0
Proteins matching the same set of peptides:
ZN711_MOUSE Total score: 31 Peptides matched: 1
Proteins matching a subset of these peptides:
Unassigned list
---------------
CB BOLD 14 442.228302 1( 1) IAIRGLLK 28.47 0
CB BOLD 22 1101.536621 1( 1) ITVSTSGLVPK 14.40 0
CB BOLD 9 747.396179 1( 1) DAEDVAK 13.59 0
CB BOLD 23 1101.621704 1( 1) QLLMVAGVDR 12.04 0
CB BOLD 8 714.372498 1( 1) LAPAQSK 10.69 0
CB BOLD 4 662.275574 1( 1) AGNAVCK 9.73 0
CB BOLD 30 663.837891 1( 1) AQLLEINEKLR 9.54 0
CB BOLD 57 747.036072 1( 1) AMWRLVDEMVQDGFPTTAR 9.05 0
CB BOLD 55 1099.094727 1( 1) LNAEAVRTLLSANGQKPSEAK 8.05 0
CB BOLD 29 642.353577 1( 1) VVGVAGQGASALVR 7.91 0
CB BOLD 6 673.349487 1( 1) AVLGGTR 7.59 0
CB BOLD 28 642.352600 1( 1) KNVSVSQGPDPR 7.22 0
CB BOLD 38 749.383972 1( 1) QSTMQRSAAGTSTR 7.10 0
CB BOLD 50 1048.561523 1( 1) ALDEILEYQNYPVVCAKK 5.70 0
CB BOLD 49 1020.987915 1( 1) VEPPGDKTLKPGPGAHSPEK 5.49 0
CB BOLD 19 932.364380 1( 1) MHNLMDR 4.61 0
CB BOLD 20 933.499023 1( 1) SRDPGMVR 3.21 0
CB BOLD 47 665.009583 1( 1) QTLQVFKYYLMDENGK 2.25 0
CB BOLD 41 886.405884 1( 1) AGLELADSPVTPEMLGR 1.93 0
CB BOLD 18 930.703003 1( 1) ASRAQLER 1.60 0
CB BOLD 7 711.364685 1( 1) GGAHEIK 1.34 0
CB BOLD 32 711.370728 1( 1) DKAIGYTSCGNHR 1.20 0
CB BOLD 17 930.683105 1( 1) KIQAEITK 1.00 0
CB BOLD 44 949.550720 1( 1) LAARWLAEHPHAPSSVR 0.76 0
CB BOLD 43 933.003784 1( 1) ISATCVPSAVQKWFAEK 0.70 0
CB BOLD 1 498.272888 1( 1) 0.00 0
CB BOLD 2 500.256012 1( 1) 0.00 0
CB BOLD 3 575.558411 1( 1) 0.00 0
CB BOLD 5 662.417175 1( 1) 0.00 0
CB BOLD 10 747.412476 1( 1) 0.00 0
CB BOLD 42 932.460815 1( 1) 0.00 0
CB BOLD 56 1119.045166 1( 1) 0.00 0
CB BOLD 63 832.798584 1( 1) 0.00 0
CB BOLD 66 1113.894653 1( 1) 0.00 0
CB BOLD 67 1116.177490 1( 1) 0.00 0
Score Delta Hit Protein Peptide
Accessions that matched query 97 rank 1:-
*/